Dev Radar
Support
LiveUpdated 2026-09-22 09:16 UTC

martin-steinegger.github.io

martin-steinegger.github.io is Started by Martin Steinegger as AF2 port to WebGPU. It is ranked #859 on the Dev Radar, in AI dev tools, first seen 4 days ago and shared in 1 post (22.1k views).

Visit martin-steinegger.github.io

What martin-steinegger.github.io says about itself

Run AlphaFold2 monomer inference locally in your browser with WebGPU.

AlphaFold2 using MMseqs2 and WebGPU AlphaFold2 using MMseqs2 and WebGPU 01 Prediction input 59 residues Job name Alignment MMseqs2 MSA Single sequence Custom A3M Protein sequence PIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEMAKGHFGIGGELASK Use : to specify inter-protein chainbreaks for modeling complexes (supports homo- and hetero-oligomers). Custom alignment (.a3m) Choose an A3M file Accepts monomer A3M or ColabFold's serialized complex-A3M format. Template structure (optional) Choose a PDB or mmCIF file Folds the query against a structure you provide. Chain Remove template Advanced settings Recycles 0 1 3 6 20 (AlphaFold-Multimer) Random…

What people said about martin-steinegger.github.io on X

This is so amazing, runs in seconds on a M5 Mac, my go to now

@MartinPacesa, 4 days ago · 239 likes · see the post

Alternatives to martin-steinegger.github.io

martin-steinegger.github.io in numbers

FAQ

What is martin-steinegger.github.io?

Started by Martin Steinegger as AF2 port to WebGPU It was first shared on X 4 days ago and is ranked #859 on the Dev Radar.

Is martin-steinegger.github.io free?

Yes, it is free to use.

Who shared martin-steinegger.github.io?

1 account on X, including @MartinPacesa, in 1 post totalling 22.1k views.

Every post is read and classified by Jev (TypeSafe): what it is, which market it belongs to, and whether the link is a real tool. 20.7k posts from 4.9k X accounts over the last 21 days, 2.4k tools, 12 markets. Collected every 5 minutes, fully re-ranked every hour — last update 2026-09-22 09:16 UTC. Full method.